Placeholder image of a protein
Icon representing a puzzle

1237: Unsolved De-novo Freestyle 80

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
May 23, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 8,529
  2. Avatar for xkcd 12. xkcd 2 pts. 8,516
  3. Avatar for Deleted group 13. Deleted group pts. 8,500
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,309
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 7,768
  6. Avatar for LCC Organic Chemistry 16. LCC Organic Chemistry 1 pt. 6,922
  7. Avatar for freefolder 17. freefolder 1 pt. 6,450
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 6,258
  9. Avatar for TheBirds 19. TheBirds 1 pt. 4,645
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 4,621

  1. Avatar for yhevalet 181. yhevalet Lv 1 1 pt. 0
  2. Avatar for Paulo Roque 182. Paulo Roque Lv 1 1 pt. 0
  3. Avatar for dettingen 183. dettingen Lv 1 1 pt. 0
  4. Avatar for Astronoma 184. Astronoma Lv 1 1 pt. 0
  5. Avatar for aminal 185. aminal Lv 1 1 pt. 0
  6. Avatar for heyubob 186. heyubob Lv 1 1 pt. 0
  7. Avatar for xrossy05 187. xrossy05 Lv 1 1 pt. 0
  8. Avatar for noforgiven 188. noforgiven Lv 1 1 pt. 0
  9. Avatar for ivalnic 189. ivalnic Lv 1 1 pt. 0
  10. Avatar for YGK 190. YGK Lv 1 1 pt. 0

Comments