Placeholder image of a protein
Icon representing a puzzle

1237: Unsolved De-novo Freestyle 80

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 8,529
  2. Avatar for xkcd 12. xkcd 2 pts. 8,516
  3. Avatar for Deleted group 13. Deleted group pts. 8,500
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,309
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 7,768
  6. Avatar for LCC Organic Chemistry 16. LCC Organic Chemistry 1 pt. 6,922
  7. Avatar for freefolder 17. freefolder 1 pt. 6,450
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 6,258
  9. Avatar for TheBirds 19. TheBirds 1 pt. 4,645
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 4,621
  1. Avatar for alcor29 11. alcor29 Lv 1 77 pts. 8,917
  2. Avatar for Fetztastic 12. Fetztastic Lv 1 75 pts. 8,910
  3. Avatar for Skippysk8s 13. Skippysk8s Lv 1 73 pts. 8,899
  4. Avatar for gitwut 14. gitwut Lv 1 71 pts. 8,897
  5. Avatar for D001x_ErlandStevens 15. D001x_ErlandStevens Lv 1 69 pts. 8,886
  6. Avatar for christioanchauvin 16. christioanchauvin Lv 1 67 pts. 8,885
  7. Avatar for crpainter 17. crpainter Lv 1 65 pts. 8,873
  8. Avatar for mirp 18. mirp Lv 1 63 pts. 8,873
  9. Avatar for Timo van der Laan 19. Timo van der Laan Lv 1 62 pts. 8,858
  10. Avatar for KarenCH 20. KarenCH Lv 1 60 pts. 8,852

Comments