Placeholder image of a protein
Icon representing a puzzle

1237: Unsolved De-novo Freestyle 80

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,106
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,095
  3. Avatar for Gargleblasters 3. Gargleblasters 58 pts. 9,028
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 9,022
  5. Avatar for D001x Med Chem MOOC 5. D001x Med Chem MOOC 31 pts. 8,886
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 8,885
  7. Avatar for Go Science 7. Go Science 15 pts. 8,874
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 8,858
  9. Avatar for Deleted group 9. Deleted group pts. 8,749
  10. Avatar for It's over 9000! 10. It's over 9000! 5 pts. 8,545
  1. Avatar for alcor29 11. alcor29 Lv 1 77 pts. 8,917
  2. Avatar for Fetztastic 12. Fetztastic Lv 1 75 pts. 8,910
  3. Avatar for Skippysk8s 13. Skippysk8s Lv 1 73 pts. 8,899
  4. Avatar for gitwut 14. gitwut Lv 1 71 pts. 8,897
  5. Avatar for D001x_ErlandStevens 15. D001x_ErlandStevens Lv 1 69 pts. 8,886
  6. Avatar for christioanchauvin 16. christioanchauvin Lv 1 67 pts. 8,885
  7. Avatar for crpainter 17. crpainter Lv 1 65 pts. 8,873
  8. Avatar for mirp 18. mirp Lv 1 63 pts. 8,873
  9. Avatar for Timo van der Laan 19. Timo van der Laan Lv 1 62 pts. 8,858
  10. Avatar for KarenCH 20. KarenCH Lv 1 60 pts. 8,852

Comments