Placeholder image of a protein
Icon representing a puzzle

1237: Unsolved De-novo Freestyle 80

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
May 23, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS

Top groups


  1. Avatar for Contenders 100 pts. 9,106
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,095
  3. Avatar for Gargleblasters 3. Gargleblasters 58 pts. 9,028
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 9,022
  5. Avatar for D001x Med Chem MOOC 5. D001x Med Chem MOOC 31 pts. 8,886
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 8,885
  7. Avatar for Go Science 7. Go Science 15 pts. 8,874
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 8,858
  9. Avatar for Deleted group 9. Deleted group pts. 8,749
  10. Avatar for It's over 9000! 10. It's over 9000! 5 pts. 8,545

  1. Avatar for harvardman 91. harvardman Lv 1 5 pts. 8,204
  2. Avatar for Crossed Sticks 92. Crossed Sticks Lv 1 5 pts. 8,187
  3. Avatar for Origami314 93. Origami314 Lv 1 4 pts. 8,173
  4. Avatar for froggs554 94. froggs554 Lv 1 4 pts. 8,172
  5. Avatar for Alistair69 95. Alistair69 Lv 1 4 pts. 8,163
  6. Avatar for Maerim 96. Maerim Lv 1 4 pts. 8,139
  7. Avatar for ecali 97. ecali Lv 1 4 pts. 8,129
  8. Avatar for cacogen_man 98. cacogen_man Lv 1 3 pts. 8,121
  9. Avatar for Merf 99. Merf Lv 1 3 pts. 8,108
  10. Avatar for ManVsYard 100. ManVsYard Lv 1 3 pts. 8,096

Comments