Placeholder image of a protein
Icon representing a puzzle

1237: Unsolved De-novo Freestyle 80

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
May 23, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS

Top groups


  1. Avatar for Contenders 100 pts. 9,106
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,095
  3. Avatar for Gargleblasters 3. Gargleblasters 58 pts. 9,028
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 9,022
  5. Avatar for D001x Med Chem MOOC 5. D001x Med Chem MOOC 31 pts. 8,886
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 8,885
  7. Avatar for Go Science 7. Go Science 15 pts. 8,874
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 8,858
  9. Avatar for Deleted group 9. Deleted group pts. 8,749
  10. Avatar for It's over 9000! 10. It's over 9000! 5 pts. 8,545

  1. Avatar for Bletchley Park 71. Bletchley Park Lv 1 11 pts. 8,455
  2. Avatar for toshiue 72. toshiue Lv 1 10 pts. 8,451
  3. Avatar for pfirth 73. pfirth Lv 1 10 pts. 8,448
  4. Avatar for tallguy-13088 74. tallguy-13088 Lv 1 10 pts. 8,447
  5. Avatar for diamonddays 75. diamonddays Lv 1 9 pts. 8,439
  6. Avatar for weitzen 76. weitzen Lv 1 9 pts. 8,434
  7. Avatar for Deleted player 77. Deleted player pts. 8,428
  8. Avatar for Marvelz 78. Marvelz Lv 1 8 pts. 8,417
  9. Avatar for bx7gn 79. bx7gn Lv 1 8 pts. 8,403
  10. Avatar for ViJay7019 80. ViJay7019 Lv 1 8 pts. 8,388

Comments