Placeholder image of a protein
Icon representing a puzzle

1238: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,385
  2. Avatar for It's over 9000! 12. It's over 9000! 3 pts. 9,315
  3. Avatar for Russian team 13. Russian team 2 pts. 9,232
  4. Avatar for freefolder 14. freefolder 1 pt. 9,149
  5. Avatar for xkcd 15. xkcd 1 pt. 9,134
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,055
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 9,054
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 9,043
  9. Avatar for BCC 19. BCC 1 pt. 8,738
  10. Avatar for Mojo Risin' 20. Mojo Risin' 1 pt. 8,655
  1. Avatar for DodoBird 71. DodoBird Lv 1 11 pts. 9,322
  2. Avatar for BCAA 72. BCAA Lv 1 11 pts. 9,315
  3. Avatar for SKSbell 73. SKSbell Lv 1 10 pts. 9,299
  4. Avatar for jamiexq 74. jamiexq Lv 1 10 pts. 9,297
  5. Avatar for guineapig 75. guineapig Lv 1 10 pts. 9,284
  6. Avatar for tarimo 76. tarimo Lv 1 9 pts. 9,274
  7. Avatar for egran48 77. egran48 Lv 1 9 pts. 9,267
  8. Avatar for Mike Lewis 78. Mike Lewis Lv 1 8 pts. 9,262
  9. Avatar for Merf 79. Merf Lv 1 8 pts. 9,256
  10. Avatar for johngran 80. johngran Lv 1 8 pts. 9,253

Comments