Placeholder image of a protein
Icon representing a puzzle

1238: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,856
  2. Avatar for Void Crushers 2. Void Crushers 79 pts. 9,727
  3. Avatar for Contenders 3. Contenders 61 pts. 9,725
  4. Avatar for Go Science 4. Go Science 47 pts. 9,702
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 35 pts. 9,672
  6. Avatar for D001x Med Chem MOOC 6. D001x Med Chem MOOC 26 pts. 9,634
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 9,625
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,621
  9. Avatar for Deleted group 9. Deleted group pts. 9,548
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,491
  1. Avatar for DodoBird 71. DodoBird Lv 1 11 pts. 9,322
  2. Avatar for BCAA 72. BCAA Lv 1 11 pts. 9,315
  3. Avatar for SKSbell 73. SKSbell Lv 1 10 pts. 9,299
  4. Avatar for jamiexq 74. jamiexq Lv 1 10 pts. 9,297
  5. Avatar for guineapig 75. guineapig Lv 1 10 pts. 9,284
  6. Avatar for tarimo 76. tarimo Lv 1 9 pts. 9,274
  7. Avatar for egran48 77. egran48 Lv 1 9 pts. 9,267
  8. Avatar for Mike Lewis 78. Mike Lewis Lv 1 8 pts. 9,262
  9. Avatar for Merf 79. Merf Lv 1 8 pts. 9,256
  10. Avatar for johngran 80. johngran Lv 1 8 pts. 9,253

Comments