Placeholder image of a protein
Icon representing a puzzle

1238: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
May 24, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 9,385
  2. Avatar for It's over 9000! 12. It's over 9000! 3 pts. 9,315
  3. Avatar for Russian team 13. Russian team 2 pts. 9,232
  4. Avatar for freefolder 14. freefolder 1 pt. 9,149
  5. Avatar for xkcd 15. xkcd 1 pt. 9,134
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,055
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 9,054
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 9,043
  9. Avatar for BCC 19. BCC 1 pt. 8,738
  10. Avatar for Mojo Risin' 20. Mojo Risin' 1 pt. 8,655

  1. Avatar for pfirth 81. pfirth Lv 1 8 pts. 9,252
  2. Avatar for altejoh 82. altejoh Lv 1 7 pts. 9,248
  3. Avatar for WarpSpeed 83. WarpSpeed Lv 1 7 pts. 9,246
  4. Avatar for pmthomson90 84. pmthomson90 Lv 1 7 pts. 9,239
  5. Avatar for ratqueen03 85. ratqueen03 Lv 1 6 pts. 9,238
  6. Avatar for ComputerMage 86. ComputerMage Lv 1 6 pts. 9,232
  7. Avatar for dizzywings 87. dizzywings Lv 1 6 pts. 9,221
  8. Avatar for 19972412 88. 19972412 Lv 1 6 pts. 9,217
  9. Avatar for Fetztastic 89. Fetztastic Lv 1 5 pts. 9,217
  10. Avatar for TraeKooi 90. TraeKooi Lv 1 5 pts. 9,215

Comments