Placeholder image of a protein
Icon representing a puzzle

1238: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 24, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups


  1. Avatar for Beta Folders 100 pts. 9,856
  2. Avatar for Void Crushers 2. Void Crushers 79 pts. 9,727
  3. Avatar for Contenders 3. Contenders 61 pts. 9,725
  4. Avatar for Go Science 4. Go Science 47 pts. 9,702
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 35 pts. 9,672
  6. Avatar for D001x Med Chem MOOC 6. D001x Med Chem MOOC 26 pts. 9,634
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 9,625
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,621
  9. Avatar for Deleted group 9. Deleted group pts. 9,548
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,491

  1. Avatar for pfirth 81. pfirth Lv 1 8 pts. 9,252
  2. Avatar for altejoh 82. altejoh Lv 1 7 pts. 9,248
  3. Avatar for WarpSpeed 83. WarpSpeed Lv 1 7 pts. 9,246
  4. Avatar for pmthomson90 84. pmthomson90 Lv 1 7 pts. 9,239
  5. Avatar for ratqueen03 85. ratqueen03 Lv 1 6 pts. 9,238
  6. Avatar for ComputerMage 86. ComputerMage Lv 1 6 pts. 9,232
  7. Avatar for dizzywings 87. dizzywings Lv 1 6 pts. 9,221
  8. Avatar for 19972412 88. 19972412 Lv 1 6 pts. 9,217
  9. Avatar for Fetztastic 89. Fetztastic Lv 1 5 pts. 9,217
  10. Avatar for TraeKooi 90. TraeKooi Lv 1 5 pts. 9,215

Comments