Placeholder image of a protein
Icon representing a puzzle

1238: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 7,990
  2. Avatar for ricg test group 22. ricg test group 1 pt. 0
  1. Avatar for alcor29 31. alcor29 Lv 1 44 pts. 9,518
  2. Avatar for Satina 32. Satina Lv 1 42 pts. 9,507
  3. Avatar for frood66 33. frood66 Lv 1 41 pts. 9,502
  4. Avatar for caglar 34. caglar Lv 1 40 pts. 9,501
  5. Avatar for pvc78 35. pvc78 Lv 1 39 pts. 9,498
  6. Avatar for dembones 36. dembones Lv 1 37 pts. 9,496
  7. Avatar for NinjaGreg 37. NinjaGreg Lv 1 36 pts. 9,493
  8. Avatar for andrey 38. andrey Lv 1 35 pts. 9,491
  9. Avatar for toshiue 39. toshiue Lv 1 34 pts. 9,480
  10. Avatar for mimi 40. mimi Lv 1 33 pts. 9,479

Comments