Placeholder image of a protein
Icon representing a puzzle

1238: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,856
  2. Avatar for Void Crushers 2. Void Crushers 79 pts. 9,727
  3. Avatar for Contenders 3. Contenders 61 pts. 9,725
  4. Avatar for Go Science 4. Go Science 47 pts. 9,702
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 35 pts. 9,672
  6. Avatar for D001x Med Chem MOOC 6. D001x Med Chem MOOC 26 pts. 9,634
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 9,625
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,621
  9. Avatar for Deleted group 9. Deleted group pts. 9,548
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,491
  1. Avatar for alcor29 31. alcor29 Lv 1 44 pts. 9,518
  2. Avatar for Satina 32. Satina Lv 1 42 pts. 9,507
  3. Avatar for frood66 33. frood66 Lv 1 41 pts. 9,502
  4. Avatar for caglar 34. caglar Lv 1 40 pts. 9,501
  5. Avatar for pvc78 35. pvc78 Lv 1 39 pts. 9,498
  6. Avatar for dembones 36. dembones Lv 1 37 pts. 9,496
  7. Avatar for NinjaGreg 37. NinjaGreg Lv 1 36 pts. 9,493
  8. Avatar for andrey 38. andrey Lv 1 35 pts. 9,491
  9. Avatar for toshiue 39. toshiue Lv 1 34 pts. 9,480
  10. Avatar for mimi 40. mimi Lv 1 33 pts. 9,479

Comments