Placeholder image of a protein
Icon representing a puzzle

1243: Unsolved De-novo Freestyle 81

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 07, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 8,083
  2. Avatar for xkcd 12. xkcd 1 pt. 8,061
  3. Avatar for Team China 13. Team China 1 pt. 8,026
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 7,904
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 7,840
  6. Avatar for KaosKorp 16. KaosKorp 1 pt. 7,450
  7. Avatar for TheBirds 17. TheBirds 1 pt. 6,678
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 3,945
  9. Avatar for BCC 19. BCC 1 pt. 0
  1. Avatar for johngran 101. johngran Lv 1 2 pts. 7,925
  2. Avatar for sean4046 102. sean4046 Lv 1 2 pts. 7,924
  3. Avatar for spmm 103. spmm Lv 1 2 pts. 7,918
  4. Avatar for guineapig 104. guineapig Lv 1 2 pts. 7,906
  5. Avatar for aendgraend 105. aendgraend Lv 1 2 pts. 7,904
  6. Avatar for crpainter 106. crpainter Lv 1 2 pts. 7,891
  7. Avatar for Squirrely 107. Squirrely Lv 1 2 pts. 7,887
  8. Avatar for Ashrai 108. Ashrai Lv 1 2 pts. 7,881
  9. Avatar for Alistair69 109. Alistair69 Lv 1 2 pts. 7,878
  10. Avatar for Sydefecks 110. Sydefecks Lv 1 2 pts. 7,864

Comments

Mike Lewis Lv 1

Is the Rama map not available on this puzzle?

It's not visible on Original interface and greyed out on Selection, but a team member is using it. He is using devprev I am using main.