Placeholder image of a protein
Icon representing a puzzle

1243: Unsolved De-novo Freestyle 81

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 07, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,683
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 8,676
  3. Avatar for Contenders 3. Contenders 56 pts. 8,660
  4. Avatar for Beta Folders 4. Beta Folders 41 pts. 8,626
  5. Avatar for D001x Med Chem MOOC 5. D001x Med Chem MOOC 29 pts. 8,610
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 8,590
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 8,480
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 8,451
  9. Avatar for Deleted group 9. Deleted group pts. 8,161
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 4 pts. 8,103
  1. Avatar for johngran 101. johngran Lv 1 2 pts. 7,925
  2. Avatar for sean4046 102. sean4046 Lv 1 2 pts. 7,924
  3. Avatar for spmm 103. spmm Lv 1 2 pts. 7,918
  4. Avatar for guineapig 104. guineapig Lv 1 2 pts. 7,906
  5. Avatar for aendgraend 105. aendgraend Lv 1 2 pts. 7,904
  6. Avatar for crpainter 106. crpainter Lv 1 2 pts. 7,891
  7. Avatar for Squirrely 107. Squirrely Lv 1 2 pts. 7,887
  8. Avatar for Ashrai 108. Ashrai Lv 1 2 pts. 7,881
  9. Avatar for Alistair69 109. Alistair69 Lv 1 2 pts. 7,878
  10. Avatar for Sydefecks 110. Sydefecks Lv 1 2 pts. 7,864

Comments

Mike Lewis Lv 1

Is the Rama map not available on this puzzle?

It's not visible on Original interface and greyed out on Selection, but a team member is using it. He is using devprev I am using main.