Placeholder image of a protein
Icon representing a puzzle

1243: Unsolved De-novo Freestyle 81

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 07, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 8,083
  2. Avatar for xkcd 12. xkcd 1 pt. 8,061
  3. Avatar for Team China 13. Team China 1 pt. 8,026
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 7,904
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 7,840
  6. Avatar for KaosKorp 16. KaosKorp 1 pt. 7,450
  7. Avatar for TheBirds 17. TheBirds 1 pt. 6,678
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 3,945
  9. Avatar for BCC 19. BCC 1 pt. 0
  1. Avatar for 01010011111 151. 01010011111 Lv 1 1 pt. 6,946
  2. Avatar for rezaefar 152. rezaefar Lv 1 1 pt. 6,897
  3. Avatar for brennakennedy-moore 153. brennakennedy-moore Lv 1 1 pt. 6,896
  4. Avatar for emtonsti 154. emtonsti Lv 1 1 pt. 6,869
  5. Avatar for lamoille 155. lamoille Lv 1 1 pt. 6,846
  6. Avatar for AndriiMiller 156. AndriiMiller Lv 1 1 pt. 6,678
  7. Avatar for DScott 157. DScott Lv 1 1 pt. 6,671
  8. Avatar for DrTree 158. DrTree Lv 1 1 pt. 6,649
  9. Avatar for pizpot 159. pizpot Lv 1 1 pt. 6,570
  10. Avatar for vLime 160. vLime Lv 1 1 pt. 6,427

Comments

Mike Lewis Lv 1

Is the Rama map not available on this puzzle?

It's not visible on Original interface and greyed out on Selection, but a team member is using it. He is using devprev I am using main.