Placeholder image of a protein
Icon representing a puzzle

1243: Unsolved De-novo Freestyle 81

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 07, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 8,083
  2. Avatar for xkcd 12. xkcd 1 pt. 8,061
  3. Avatar for Team China 13. Team China 1 pt. 8,026
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 7,904
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 7,840
  6. Avatar for KaosKorp 16. KaosKorp 1 pt. 7,450
  7. Avatar for TheBirds 17. TheBirds 1 pt. 6,678
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 3,945
  9. Avatar for BCC 19. BCC 1 pt. 0
  1. Avatar for andrewxc 31. andrewxc Lv 1 41 pts. 8,405
  2. Avatar for georg137 32. georg137 Lv 1 40 pts. 8,403
  3. Avatar for fiendish_ghoul 33. fiendish_ghoul Lv 1 39 pts. 8,402
  4. Avatar for harvardman 34. harvardman Lv 1 37 pts. 8,399
  5. Avatar for mimi 35. mimi Lv 1 36 pts. 8,394
  6. Avatar for egran48 36. egran48 Lv 1 35 pts. 8,389
  7. Avatar for Crossed Sticks 37. Crossed Sticks Lv 1 34 pts. 8,389
  8. Avatar for MurloW 38. MurloW Lv 1 33 pts. 8,385
  9. Avatar for hpaege 39. hpaege Lv 1 32 pts. 8,385
  10. Avatar for g_b 40. g_b Lv 1 31 pts. 8,363

Comments

Mike Lewis Lv 1

Is the Rama map not available on this puzzle?

It's not visible on Original interface and greyed out on Selection, but a team member is using it. He is using devprev I am using main.