Placeholder image of a protein
Icon representing a puzzle

1243: Unsolved De-novo Freestyle 81

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 07, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,683
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 8,676
  3. Avatar for Contenders 3. Contenders 56 pts. 8,660
  4. Avatar for Beta Folders 4. Beta Folders 41 pts. 8,626
  5. Avatar for D001x Med Chem MOOC 5. D001x Med Chem MOOC 29 pts. 8,610
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 8,590
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 8,480
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 8,451
  9. Avatar for Deleted group 9. Deleted group pts. 8,161
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 4 pts. 8,103
  1. Avatar for andrewxc 31. andrewxc Lv 1 41 pts. 8,405
  2. Avatar for georg137 32. georg137 Lv 1 40 pts. 8,403
  3. Avatar for fiendish_ghoul 33. fiendish_ghoul Lv 1 39 pts. 8,402
  4. Avatar for harvardman 34. harvardman Lv 1 37 pts. 8,399
  5. Avatar for mimi 35. mimi Lv 1 36 pts. 8,394
  6. Avatar for egran48 36. egran48 Lv 1 35 pts. 8,389
  7. Avatar for Crossed Sticks 37. Crossed Sticks Lv 1 34 pts. 8,389
  8. Avatar for MurloW 38. MurloW Lv 1 33 pts. 8,385
  9. Avatar for hpaege 39. hpaege Lv 1 32 pts. 8,385
  10. Avatar for g_b 40. g_b Lv 1 31 pts. 8,363

Comments

Mike Lewis Lv 1

Is the Rama map not available on this puzzle?

It's not visible on Original interface and greyed out on Selection, but a team member is using it. He is using devprev I am using main.