Placeholder image of a protein
Icon representing a puzzle

1243: Unsolved De-novo Freestyle 81

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
June 07, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups


  1. Avatar for Go Science 100 pts. 8,683
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 8,676
  3. Avatar for Contenders 3. Contenders 56 pts. 8,660
  4. Avatar for Beta Folders 4. Beta Folders 41 pts. 8,626
  5. Avatar for D001x Med Chem MOOC 5. D001x Med Chem MOOC 29 pts. 8,610
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 8,590
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 8,480
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 8,451
  9. Avatar for Deleted group 9. Deleted group pts. 8,161
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 4 pts. 8,103

  1. Avatar for 01010011111 151. 01010011111 Lv 1 1 pt. 6,946
  2. Avatar for rezaefar 152. rezaefar Lv 1 1 pt. 6,897
  3. Avatar for emtonsti 154. emtonsti Lv 1 1 pt. 6,869
  4. Avatar for lamoille 155. lamoille Lv 1 1 pt. 6,846
  5. Avatar for AndriiMiller 156. AndriiMiller Lv 1 1 pt. 6,678
  6. Avatar for DScott 157. DScott Lv 1 1 pt. 6,671
  7. Avatar for DrTree 158. DrTree Lv 1 1 pt. 6,649
  8. Avatar for pizpot 159. pizpot Lv 1 1 pt. 6,570
  9. Avatar for vLime 160. vLime Lv 1 1 pt. 6,427

Comments


Mike Lewis Lv 1

Is the Rama map not available on this puzzle?

It's not visible on Original interface and greyed out on Selection, but a team member is using it. He is using devprev I am using main.