Placeholder image of a protein
Icon representing a puzzle

1243: Unsolved De-novo Freestyle 81

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 07, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,683
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 8,676
  3. Avatar for Contenders 3. Contenders 56 pts. 8,660
  4. Avatar for Beta Folders 4. Beta Folders 41 pts. 8,626
  5. Avatar for D001x Med Chem MOOC 5. D001x Med Chem MOOC 29 pts. 8,610
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 8,590
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 8,480
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 8,451
  9. Avatar for Deleted group 9. Deleted group pts. 8,161
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 4 pts. 8,103
  1. Avatar for dbuske 81. dbuske Lv 1 6 pts. 8,067
  2. Avatar for fryguy 82. fryguy Lv 1 6 pts. 8,061
  3. Avatar for Mike Cassidy 83. Mike Cassidy Lv 1 6 pts. 8,056
  4. Avatar for Realcrazy 84. Realcrazy Lv 1 5 pts. 8,026
  5. Avatar for deLaCeiba 85. deLaCeiba Lv 1 5 pts. 8,026
  6. Avatar for bendbob 86. bendbob Lv 1 5 pts. 8,017
  7. Avatar for JUMELLE54 87. JUMELLE54 Lv 1 5 pts. 8,015
  8. Avatar for fishercat 88. fishercat Lv 1 4 pts. 8,011
  9. Avatar for tommybruno 89. tommybruno Lv 1 4 pts. 8,009
  10. Avatar for alcor29 90. alcor29 Lv 1 4 pts. 8,000

Comments

Mike Lewis Lv 1

Is the Rama map not available on this puzzle?

It's not visible on Original interface and greyed out on Selection, but a team member is using it. He is using devprev I am using main.