Placeholder image of a protein
Icon representing a puzzle

1243: Unsolved De-novo Freestyle 81

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 07, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,683
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 8,676
  3. Avatar for Contenders 3. Contenders 56 pts. 8,660
  4. Avatar for Beta Folders 4. Beta Folders 41 pts. 8,626
  5. Avatar for D001x Med Chem MOOC 5. D001x Med Chem MOOC 29 pts. 8,610
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 8,590
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 8,480
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 8,451
  9. Avatar for Deleted group 9. Deleted group pts. 8,161
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 4 pts. 8,103
  1. Avatar for caglar 41. caglar Lv 1 30 pts. 8,363
  2. Avatar for Blipperman 42. Blipperman Lv 1 29 pts. 8,357
  3. Avatar for reefyrob 43. reefyrob Lv 1 28 pts. 8,353
  4. Avatar for WarpSpeed 44. WarpSpeed Lv 1 27 pts. 8,350
  5. Avatar for smilingone 45. smilingone Lv 1 26 pts. 8,327
  6. Avatar for toshiue 46. toshiue Lv 1 25 pts. 8,324
  7. Avatar for LociOiling 47. LociOiling Lv 1 24 pts. 8,300
  8. Avatar for heather-1 48. heather-1 Lv 1 23 pts. 8,295
  9. Avatar for NinjaGreg 49. NinjaGreg Lv 1 22 pts. 8,289
  10. Avatar for mho 50. mho Lv 1 22 pts. 8,286

Comments

Mike Lewis Lv 1

Is the Rama map not available on this puzzle?

It's not visible on Original interface and greyed out on Selection, but a team member is using it. He is using devprev I am using main.