Placeholder image of a protein
Icon representing a puzzle

1244: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for xkcd 11. xkcd 1 pt. 8,591
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,498
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,484
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 6,655
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 6,400

  1. Avatar for Skippysk8s
    1. Skippysk8s Lv 1
    100 pts. 9,909
  2. Avatar for Mike Lewis 2. Mike Lewis Lv 1 88 pts. 9,907
  3. Avatar for Fat Tony 3. Fat Tony Lv 1 76 pts. 9,906
  4. Avatar for frood66 4. frood66 Lv 1 66 pts. 9,896
  5. Avatar for ManVsYard 5. ManVsYard Lv 1 57 pts. 9,895
  6. Avatar for Blipperman 6. Blipperman Lv 1 49 pts. 9,895
  7. Avatar for Norrjane 7. Norrjane Lv 1 42 pts. 9,894
  8. Avatar for Ashrai 8. Ashrai Lv 1 36 pts. 9,887
  9. Avatar for smilingone 9. smilingone Lv 1 30 pts. 9,871
  10. Avatar for actiasluna 10. actiasluna Lv 1 25 pts. 9,857

Comments