Placeholder image of a protein
Icon representing a puzzle

1244: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for xkcd 11. xkcd 1 pt. 8,591
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,498
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,484
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 6,655
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 6,400
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 0
  7. Avatar for Advanced Protein Science 2 - 2016 17. Advanced Protein Science 2 - 2016 1 pt. 0
  1. Avatar for eromana 91. eromana Lv 1 5 pts. 8,754
  2. Avatar for jermainiac 92. jermainiac Lv 1 5 pts. 8,734
  3. Avatar for dssb 93. dssb Lv 1 4 pts. 8,725
  4. Avatar for harvardman 94. harvardman Lv 1 4 pts. 8,719
  5. Avatar for Fat Tony 95. Fat Tony Lv 1 4 pts. 8,693
  6. Avatar for navn 96. navn Lv 1 4 pts. 8,678
  7. Avatar for weitzen 97. weitzen Lv 1 4 pts. 8,650
  8. Avatar for cbwest 98. cbwest Lv 1 3 pts. 8,627
  9. Avatar for Ellis Shih 99. Ellis Shih Lv 1 3 pts. 8,598
  10. Avatar for fryguy 100. fryguy Lv 1 3 pts. 8,591

Comments