Placeholder image of a protein
Icon representing a puzzle

1244: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for xkcd 11. xkcd 1 pt. 8,591
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,498
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,484
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 6,655
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 6,400
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 0
  7. Avatar for Advanced Protein Science 2 - 2016 17. Advanced Protein Science 2 - 2016 1 pt. 0
  1. Avatar for Wheeler22 111. Wheeler22 Lv 1 2 pts. 8,394
  2. Avatar for Acida-2 112. Acida-2 Lv 1 2 pts. 8,378
  3. Avatar for georg137 113. georg137 Lv 1 2 pts. 8,375
  4. Avatar for rinze 114. rinze Lv 1 2 pts. 8,363
  5. Avatar for weidanhua 115. weidanhua Lv 1 2 pts. 8,344
  6. Avatar for placid.lion 116. placid.lion Lv 1 2 pts. 8,334
  7. Avatar for tallguy-13088 117. tallguy-13088 Lv 1 1 pt. 8,325
  8. Avatar for dahast.de 118. dahast.de Lv 1 1 pt. 8,302
  9. Avatar for Voltozan 119. Voltozan Lv 1 1 pt. 8,293
  10. Avatar for Iron pet 120. Iron pet Lv 1 1 pt. 8,272

Comments