Placeholder image of a protein
Icon representing a puzzle

1244: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
June 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for xkcd 11. xkcd 1 pt. 8,591
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,498
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,484
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 6,655
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 6,400

  1. Avatar for mirjamvandelft 131. mirjamvandelft Lv 1 1 pt. 7,991
  2. Avatar for Inkedhands 132. Inkedhands Lv 1 1 pt. 7,988
  3. Avatar for NinguLilium 133. NinguLilium Lv 1 1 pt. 7,919
  4. Avatar for KingLear 134. KingLear Lv 1 1 pt. 7,914
  5. Avatar for emtonsti 135. emtonsti Lv 1 1 pt. 7,896
  6. Avatar for Deleted player 136. Deleted player 1 pt. 7,893
  7. Avatar for lightnir 137. lightnir Lv 1 1 pt. 7,892
  8. Avatar for BackBuffer 138. BackBuffer Lv 1 1 pt. 7,829
  9. Avatar for jayaygee 139. jayaygee Lv 1 1 pt. 7,731
  10. Avatar for 01010011111 140. 01010011111 Lv 1 1 pt. 7,700

Comments