Placeholder image of a protein
Icon representing a puzzle

1244: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for xkcd 11. xkcd 1 pt. 8,591
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,498
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,484
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 6,655
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 6,400
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 0
  7. Avatar for Advanced Protein Science 2 - 2016 17. Advanced Protein Science 2 - 2016 1 pt. 0
  1. Avatar for JackONeill12 151. JackONeill12 Lv 1 1 pt. 7,292
  2. Avatar for NotJim99 152. NotJim99 Lv 1 1 pt. 7,288
  3. Avatar for momadoc 153. momadoc Lv 1 1 pt. 7,253
  4. Avatar for demeter900 154. demeter900 Lv 1 1 pt. 7,251
  5. Avatar for lamoille 155. lamoille Lv 1 1 pt. 7,223
  6. Avatar for Tac1 156. Tac1 Lv 1 1 pt. 7,191
  7. Avatar for Mikodebest 157. Mikodebest Lv 1 1 pt. 7,126
  8. Avatar for RasmusVH 158. RasmusVH Lv 1 1 pt. 7,115
  9. Avatar for kryohero 159. kryohero Lv 1 1 pt. 7,096
  10. Avatar for jstoker 160. jstoker Lv 1 1 pt. 7,093

Comments