Placeholder image of a protein
Icon representing a puzzle

1244: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
June 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for xkcd 11. xkcd 1 pt. 8,591
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,498
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,484
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 6,655
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 6,400
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 0
  7. Avatar for Advanced Protein Science 2 - 2016 17. Advanced Protein Science 2 - 2016 1 pt. 0
  1. Avatar for roman madala 161. roman madala Lv 1 1 pt. 7,093
  2. Avatar for martinf 162. martinf Lv 1 1 pt. 7,086
  3. Avatar for dennis9724 163. dennis9724 Lv 1 1 pt. 7,055
  4. Avatar for scottwuzhear 164. scottwuzhear Lv 1 1 pt. 7,046
  5. Avatar for tela 165. tela Lv 1 1 pt. 7,043
  6. Avatar for xolroc 166. xolroc Lv 1 1 pt. 7,037
  7. Avatar for v0slu 167. v0slu Lv 1 1 pt. 7,005
  8. Avatar for Racheal 168. Racheal Lv 1 1 pt. 7,004
  9. Avatar for Sydefecks 169. Sydefecks Lv 1 1 pt. 6,982
  10. Avatar for me357 170. me357 Lv 1 1 pt. 6,933

Comments