Placeholder image of a protein
Icon representing a puzzle

1244: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for xkcd 11. xkcd 1 pt. 8,591
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,498
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,484
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 6,655
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 6,400
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 0
  7. Avatar for Advanced Protein Science 2 - 2016 17. Advanced Protein Science 2 - 2016 1 pt. 0
  1. Avatar for DJtepapa 171. DJtepapa Lv 1 1 pt. 6,920
  2. Avatar for bob1928 172. bob1928 Lv 1 1 pt. 6,863
  3. Avatar for TunLeft25 173. TunLeft25 Lv 1 1 pt. 6,857
  4. Avatar for phi16 174. phi16 Lv 1 1 pt. 6,816
  5. Avatar for Neil_CZ 175. Neil_CZ Lv 1 1 pt. 6,655
  6. Avatar for Hollinas 176. Hollinas Lv 1 1 pt. 6,581
  7. Avatar for aspadistra 177. aspadistra Lv 1 1 pt. 6,400
  8. Avatar for bcd 178. bcd Lv 1 1 pt. 6,350
  9. Avatar for jeacom 179. jeacom Lv 1 1 pt. 6,143
  10. Avatar for vLime 180. vLime Lv 1 1 pt. 5,912

Comments