Placeholder image of a protein
Icon representing a puzzle

1244: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for xkcd 11. xkcd 1 pt. 8,591
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,498
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,484
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 6,655
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 6,400
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 0
  7. Avatar for Advanced Protein Science 2 - 2016 17. Advanced Protein Science 2 - 2016 1 pt. 0
  1. Avatar for robkleffner 181. robkleffner Lv 1 1 pt. 5,349
  2. Avatar for Museka 182. Museka Lv 1 1 pt. 4,080
  3. Avatar for zakmiller 183. zakmiller Lv 1 1 pt. 4,015
  4. Avatar for NaorSolimany 184. NaorSolimany Lv 1 1 pt. 0
  5. Avatar for Jajaboman 185. Jajaboman Lv 1 1 pt. 0
  6. Avatar for Susume 186. Susume Lv 1 1 pt. 0
  7. Avatar for Dempy 187. Dempy Lv 1 1 pt. 0
  8. Avatar for Paulo Roque 188. Paulo Roque Lv 1 1 pt. 0
  9. Avatar for edpalas 189. edpalas Lv 1 1 pt. 0
  10. Avatar for alcor29 190. alcor29 Lv 1 1 pt. 0

Comments