Placeholder image of a protein
Icon representing a puzzle

1244: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
June 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for xkcd 11. xkcd 1 pt. 8,591
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,498
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,484
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 6,655
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 6,400

  1. Avatar for Vinara 31. Vinara Lv 1 43 pts. 9,674
  2. Avatar for actiasluna 32. actiasluna Lv 1 42 pts. 9,665
  3. Avatar for reefyrob 33. reefyrob Lv 1 41 pts. 9,657
  4. Avatar for Mike Lewis 34. Mike Lewis Lv 1 39 pts. 9,645
  5. Avatar for nicobul 35. nicobul Lv 1 38 pts. 9,645
  6. Avatar for Norrjane 36. Norrjane Lv 1 37 pts. 9,642
  7. Avatar for grogar7 37. grogar7 Lv 1 36 pts. 9,635
  8. Avatar for smilingone 38. smilingone Lv 1 35 pts. 9,632
  9. Avatar for Bletchley Park 39. Bletchley Park Lv 1 34 pts. 9,624
  10. Avatar for Deleted player 40. Deleted player 33 pts. 9,622

Comments