Placeholder image of a protein
Icon representing a puzzle

1244: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for xkcd 11. xkcd 1 pt. 8,591
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,498
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,484
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 6,655
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 6,400
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 0
  7. Avatar for Advanced Protein Science 2 - 2016 17. Advanced Protein Science 2 - 2016 1 pt. 0
  1. Avatar for WarpSpeed 71. WarpSpeed Lv 1 11 pts. 9,324
  2. Avatar for pfirth 72. pfirth Lv 1 10 pts. 9,307
  3. Avatar for drumpeter18yrs9yrs 73. drumpeter18yrs9yrs Lv 1 10 pts. 9,286
  4. Avatar for Deleted player 74. Deleted player pts. 9,269
  5. Avatar for guineapig 75. guineapig Lv 1 9 pts. 9,243
  6. Avatar for Superphosphate 76. Superphosphate Lv 1 9 pts. 9,236
  7. Avatar for Satina 77. Satina Lv 1 9 pts. 9,162
  8. Avatar for Tehnologik1 78. Tehnologik1 Lv 1 8 pts. 9,160
  9. Avatar for Vincenzo Brancaccio 79. Vincenzo Brancaccio Lv 1 8 pts. 9,137
  10. Avatar for ManVsYard 80. ManVsYard Lv 1 8 pts. 9,129

Comments