Placeholder image of a protein
Icon representing a puzzle

1244: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for xkcd 11. xkcd 1 pt. 8,591
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,498
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,484
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 6,655
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 6,400
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 0
  7. Avatar for Advanced Protein Science 2 - 2016 17. Advanced Protein Science 2 - 2016 1 pt. 0
  1. Avatar for egran48 81. egran48 Lv 1 7 pts. 9,111
  2. Avatar for Fetztastic 82. Fetztastic Lv 1 7 pts. 9,092
  3. Avatar for TastyMunchies 83. TastyMunchies Lv 1 7 pts. 9,062
  4. Avatar for ViJay7019 84. ViJay7019 Lv 1 6 pts. 9,048
  5. Avatar for ratqueen03 85. ratqueen03 Lv 1 6 pts. 8,922
  6. Avatar for mho 86. mho Lv 1 6 pts. 8,885
  7. Avatar for Punktchen 87. Punktchen Lv 1 6 pts. 8,868
  8. Avatar for froggs554 88. froggs554 Lv 1 5 pts. 8,856
  9. Avatar for Merf 89. Merf Lv 1 5 pts. 8,766
  10. Avatar for andrewxc 90. andrewxc Lv 1 5 pts. 8,760

Comments