Placeholder image of a protein
Icon representing a puzzle

1246: Unsolved De-novo Freestyle 81: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
June 13, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1243, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1243 and use them as a starting point here.



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,540
  2. Avatar for Void Crushers 2. Void Crushers 73 pts. 9,512
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,487
  4. Avatar for Go Science 4. Go Science 36 pts. 9,411
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 9,314
  6. Avatar for Contenders 6. Contenders 16 pts. 9,305
  7. Avatar for D001x Med Chem MOOC 7. D001x Med Chem MOOC 10 pts. 9,089
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 9,078
  9. Avatar for Deleted group 9. Deleted group pts. 8,775
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,312
  1. Avatar for Timo van der Laan
    1. Timo van der Laan Lv 1
    100 pts. 9,512
  2. Avatar for grogar7 2. grogar7 Lv 1 98 pts. 9,487
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 95 pts. 9,414
  4. Avatar for jeff101 4. jeff101 Lv 1 93 pts. 9,403
  5. Avatar for mirp 5. mirp Lv 1 90 pts. 9,395
  6. Avatar for TastyMunchies 6. TastyMunchies Lv 1 88 pts. 9,361
  7. Avatar for Galaxie 7. Galaxie Lv 1 85 pts. 9,337
  8. Avatar for MurloW 8. MurloW Lv 1 83 pts. 9,328
  9. Avatar for jobo0502 9. jobo0502 Lv 1 81 pts. 9,314
  10. Avatar for Susume 10. Susume Lv 1 79 pts. 9,309

Comments