Placeholder image of a protein
Icon representing a puzzle

1246: Unsolved De-novo Freestyle 81: Predicted Contacts

Closed since over 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
June 13, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1243, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1243 and use them as a starting point here.



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,006
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 8,003
  3. Avatar for Deleted group 13. Deleted group pts. 7,870
  4. Avatar for Advanced Protein Science 2 - 2016 14. Advanced Protein Science 2 - 2016 1 pt. 7,426
  5. Avatar for freefolder 15. freefolder 1 pt. 7,247
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 5,810
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 4,813
  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 9,540
  2. Avatar for LociOiling 2. LociOiling Lv 1 88 pts. 9,529
  3. Avatar for martin.szew 3. martin.szew Lv 1 76 pts. 9,523
  4. Avatar for reefyrob 4. reefyrob Lv 1 66 pts. 9,521
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 57 pts. 9,519
  6. Avatar for bertro 6. bertro Lv 1 49 pts. 9,502
  7. Avatar for Deleted player 7. Deleted player pts. 9,501
  8. Avatar for Galaxie 8. Galaxie Lv 1 36 pts. 9,478
  9. Avatar for lamoille 9. lamoille Lv 1 30 pts. 9,469
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 25 pts. 9,411

Comments