Placeholder image of a protein
Icon representing a puzzle

1246: Unsolved De-novo Freestyle 81: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
June 13, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1243, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1243 and use them as a starting point here.



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,006
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 8,003
  3. Avatar for Deleted group 13. Deleted group pts. 7,870
  4. Avatar for Advanced Protein Science 2 - 2016 14. Advanced Protein Science 2 - 2016 1 pt. 7,426
  5. Avatar for freefolder 15. freefolder 1 pt. 7,247
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 5,810
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 4,813
  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 76 pts. 9,307
  2. Avatar for dembones 12. dembones Lv 1 74 pts. 9,294
  3. Avatar for bertro 13. bertro Lv 1 72 pts. 9,281
  4. Avatar for dcrwheeler 14. dcrwheeler Lv 1 70 pts. 9,279
  5. Avatar for gitwut 15. gitwut Lv 1 68 pts. 9,245
  6. Avatar for hpaege 16. hpaege Lv 1 66 pts. 9,220
  7. Avatar for fiendish_ghoul 17. fiendish_ghoul Lv 1 64 pts. 9,220
  8. Avatar for fishercat 18. fishercat Lv 1 63 pts. 9,213
  9. Avatar for johnmitch 19. johnmitch Lv 1 61 pts. 9,210
  10. Avatar for pmdpmd 20. pmdpmd Lv 1 59 pts. 9,202

Comments