Placeholder image of a protein
Icon representing a puzzle

1246: Unsolved De-novo Freestyle 81: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
June 13, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1243, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1243 and use them as a starting point here.



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,006
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 8,003
  3. Avatar for Deleted group 13. Deleted group pts. 7,870
  4. Avatar for freefolder 15. freefolder 1 pt. 7,247
  5. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 5,810
  6. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 4,813

  1. Avatar for egran48 41. egran48 Lv 1 31 pts. 8,981
  2. Avatar for YeshuaLives 42. YeshuaLives Lv 1 30 pts. 8,961
  3. Avatar for Crossed Sticks 43. Crossed Sticks Lv 1 29 pts. 8,953
  4. Avatar for ZeroLeak7 44. ZeroLeak7 Lv 1 28 pts. 8,949
  5. Avatar for reefyrob 45. reefyrob Lv 1 27 pts. 8,948
  6. Avatar for nicobul 46. nicobul Lv 1 26 pts. 8,946
  7. Avatar for crpainter 47. crpainter Lv 1 25 pts. 8,896
  8. Avatar for Mark- 48. Mark- Lv 1 24 pts. 8,894
  9. Avatar for manu8170 49. manu8170 Lv 1 23 pts. 8,889
  10. Avatar for heather-1 50. heather-1 Lv 1 22 pts. 8,860

Comments