Placeholder image of a protein
Icon representing a puzzle

1246: Unsolved De-novo Freestyle 81: Predicted Contacts

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Predicted Contacts Predicted Contacts

Summary


Created
June 13, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1243, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1243 and use them as a starting point here.



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups


  1. Avatar for Beta Folders 100 pts. 9,540
  2. Avatar for Void Crushers 2. Void Crushers 73 pts. 9,512
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,487
  4. Avatar for Go Science 4. Go Science 36 pts. 9,411
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 9,314
  6. Avatar for Contenders 6. Contenders 16 pts. 9,305
  7. Avatar for D001x Med Chem MOOC 7. D001x Med Chem MOOC 10 pts. 9,089
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 9,078
  9. Avatar for Deleted group 9. Deleted group pts. 8,775
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,312

  1. Avatar for JUMELLE54 101. JUMELLE54 Lv 1 3 pts. 8,250
  2. Avatar for FreeT 102. FreeT Lv 1 3 pts. 8,247
  3. Avatar for YGK 103. YGK Lv 1 2 pts. 8,236
  4. Avatar for demeter900 104. demeter900 Lv 1 2 pts. 8,223
  5. Avatar for abiogenesis 105. abiogenesis Lv 1 2 pts. 8,217
  6. Avatar for navn 106. navn Lv 1 2 pts. 8,215
  7. Avatar for johngran 107. johngran Lv 1 2 pts. 8,173
  8. Avatar for dssb 108. dssb Lv 1 2 pts. 8,170
  9. Avatar for georg137 109. georg137 Lv 1 2 pts. 8,146
  10. Avatar for Punktchen 110. Punktchen Lv 1 2 pts. 8,130

Comments