Placeholder image of a protein
Icon representing a puzzle

1246: Unsolved De-novo Freestyle 81: Predicted Contacts

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Predicted Contacts Predicted Contacts

Summary


Created
June 13, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1243, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1243 and use them as a starting point here.



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups


  1. Avatar for Beta Folders 100 pts. 9,540
  2. Avatar for Void Crushers 2. Void Crushers 73 pts. 9,512
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,487
  4. Avatar for Go Science 4. Go Science 36 pts. 9,411
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 9,314
  6. Avatar for Contenders 6. Contenders 16 pts. 9,305
  7. Avatar for D001x Med Chem MOOC 7. D001x Med Chem MOOC 10 pts. 9,089
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 9,078
  9. Avatar for Deleted group 9. Deleted group pts. 8,775
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,312

  1. Avatar for teacherguerois 161. teacherguerois Lv 1 1 pt. 6,739
  2. Avatar for kazukiyyy 162. kazukiyyy Lv 1 1 pt. 6,289
  3. Avatar for roman madala 163. roman madala Lv 1 1 pt. 6,223
  4. Avatar for Chouquet 164. Chouquet Lv 1 1 pt. 6,220
  5. Avatar for apreiskimas 165. apreiskimas Lv 1 1 pt. 6,184
  6. Avatar for pandapharmd 166. pandapharmd Lv 1 1 pt. 6,089
  7. Avatar for aspadistra 167. aspadistra Lv 1 1 pt. 5,810
  8. Avatar for jayaygee 168. jayaygee Lv 1 1 pt. 5,442
  9. Avatar for mpowroznik 169. mpowroznik Lv 1 1 pt. 5,256
  10. Avatar for adamos03 170. adamos03 Lv 1 1 pt. 5,214

Comments