Placeholder image of a protein
Icon representing a puzzle

1246: Unsolved De-novo Freestyle 81: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
June 13, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1243, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1243 and use them as a starting point here.



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups


  1. Avatar for Beta Folders 100 pts. 9,540
  2. Avatar for Void Crushers 2. Void Crushers 73 pts. 9,512
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,487
  4. Avatar for Go Science 4. Go Science 36 pts. 9,411
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 9,314
  6. Avatar for Contenders 6. Contenders 16 pts. 9,305
  7. Avatar for D001x Med Chem MOOC 7. D001x Med Chem MOOC 10 pts. 9,089
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 9,078
  9. Avatar for Deleted group 9. Deleted group pts. 8,775
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,312

  1. Avatar for martin.szew 31. martin.szew Lv 1 42 pts. 9,083
  2. Avatar for weitzen 32. weitzen Lv 1 41 pts. 9,061
  3. Avatar for Deleted player 33. Deleted player pts. 9,057
  4. Avatar for frood66 34. frood66 Lv 1 38 pts. 9,050
  5. Avatar for actiasluna 35. actiasluna Lv 1 37 pts. 9,037
  6. Avatar for pvc78 36. pvc78 Lv 1 36 pts. 9,030
  7. Avatar for LociOiling 37. LociOiling Lv 1 35 pts. 9,008
  8. Avatar for g_b 38. g_b Lv 1 34 pts. 9,002
  9. Avatar for mimi 39. mimi Lv 1 33 pts. 8,989
  10. Avatar for TomTaylor 40. TomTaylor Lv 1 32 pts. 8,987

Comments