Placeholder image of a protein
Icon representing a puzzle

1247: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
June 15, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for xkcd 11. xkcd 2 pts. 8,504
  2. Avatar for D001x Med Chem MOOC 12. D001x Med Chem MOOC 1 pt. 8,392
  3. Avatar for freefolder 13. freefolder 1 pt. 8,338
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,124
  5. Avatar for Deleted group 15. Deleted group pts. 8,118
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,769
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 7,665
  8. Avatar for BOINC@Poland 18. BOINC@Poland 1 pt. 6,737
  1. Avatar for gitwut
    1. gitwut Lv 1
    100 pts. 9,880
  2. Avatar for dembones 2. dembones Lv 1 86 pts. 9,868
  3. Avatar for Bletchley Park 3. Bletchley Park Lv 1 73 pts. 9,848
  4. Avatar for mimi 4. mimi Lv 1 62 pts. 9,845
  5. Avatar for TomTaylor 5. TomTaylor Lv 1 52 pts. 9,837
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 43 pts. 9,837
  7. Avatar for mirp 7. mirp Lv 1 36 pts. 9,824
  8. Avatar for Scopper 8. Scopper Lv 1 30 pts. 9,823
  9. Avatar for Anfinsen_slept_here 9. Anfinsen_slept_here Lv 1 24 pts. 9,822
  10. Avatar for greepski 10. greepski Lv 1 20 pts. 9,818

Comments