1247: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since over 9 years ago

Summary

• Created: June 15, 2016
• Expires: June 22, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

• 1. Contenders 100 pts. 9,880
• 2. L'Alliance Francophone 74 pts. 9,847
• 3. Go Science 54 pts. 9,837
• 4. Void Crushers 38 pts. 9,819
• 5. Gargleblasters 27 pts. 9,818
• 6. Beta Folders 18 pts. 9,817
• 7. Anthropic Dreams 12 pts. 9,805
• 8. Deleted group pts. 9,451
• 9. Italiani Al Lavoro 5 pts. 9,344
• 10. It's over 9000! 3 pts. 9,268

Top soloists

• 1. Aubade01 100 pts. 9,933
• 2. gitwut 98 pts. 9,880
• 3. pmdpmd 96 pts. 9,847
• 4. johnmitch 93 pts. 9,837
• 5. mirp 91 pts. 9,837
• 6. Timo van der Laan 89 pts. 9,819
• 7. Mark- 86 pts. 9,817
• 8. retiredmichael 84 pts. 9,817
• 9. bertro 82 pts. 9,815
• 10. LociOiling 80 pts. 9,808