Placeholder image of a protein
Icon representing a puzzle

1247: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
June 15, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for xkcd 11. xkcd 2 pts. 8,504
  2. Avatar for D001x Med Chem MOOC 12. D001x Med Chem MOOC 1 pt. 8,392
  3. Avatar for freefolder 13. freefolder 1 pt. 8,338
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,124
  5. Avatar for Deleted group 15. Deleted group pts. 8,118
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,769
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 7,665
  8. Avatar for BOINC@Poland 18. BOINC@Poland 1 pt. 6,737

  1. Avatar for Aubade01
    1. Aubade01 Lv 1
    100 pts. 9,933
  2. Avatar for gitwut 2. gitwut Lv 1 98 pts. 9,880
  3. Avatar for pmdpmd 3. pmdpmd Lv 1 96 pts. 9,847
  4. Avatar for johnmitch 4. johnmitch Lv 1 93 pts. 9,837
  5. Avatar for mirp 5. mirp Lv 1 91 pts. 9,837
  6. Avatar for Timo van der Laan 6. Timo van der Laan Lv 1 89 pts. 9,819
  7. Avatar for Mark- 7. Mark- Lv 1 86 pts. 9,817
  8. Avatar for retiredmichael 8. retiredmichael Lv 1 84 pts. 9,817
  9. Avatar for bertro 9. bertro Lv 1 82 pts. 9,815
  10. Avatar for LociOiling 10. LociOiling Lv 1 80 pts. 9,808

Comments