Placeholder image of a protein
Icon representing a puzzle

1247: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 15, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for xkcd 11. xkcd 2 pts. 8,504
  2. Avatar for D001x Med Chem MOOC 12. D001x Med Chem MOOC 1 pt. 8,392
  3. Avatar for freefolder 13. freefolder 1 pt. 8,338
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,124
  5. Avatar for Deleted group 15. Deleted group pts. 8,118
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,769
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 7,665
  8. Avatar for BOINC@Poland 18. BOINC@Poland 1 pt. 6,737
  1. Avatar for Punktchen 111. Punktchen Lv 1 2 pts. 8,416
  2. Avatar for dssb 112. dssb Lv 1 2 pts. 8,405
  3. Avatar for lockert 113. lockert Lv 1 2 pts. 8,394
  4. Avatar for D001x_ErlandStevens 114. D001x_ErlandStevens Lv 1 2 pts. 8,392
  5. Avatar for demeter900 115. demeter900 Lv 1 2 pts. 8,389
  6. Avatar for Arne Heessels 116. Arne Heessels Lv 1 2 pts. 8,352
  7. Avatar for Imeturoran 117. Imeturoran Lv 1 2 pts. 8,338
  8. Avatar for Auntecedent 118. Auntecedent Lv 1 2 pts. 8,332
  9. Avatar for esise 119. esise Lv 1 2 pts. 8,324
  10. Avatar for DScott 120. DScott Lv 1 2 pts. 8,319

Comments