Placeholder image of a protein
Icon representing a puzzle

1247: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 15, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for xkcd 11. xkcd 2 pts. 8,504
  2. Avatar for D001x Med Chem MOOC 12. D001x Med Chem MOOC 1 pt. 8,392
  3. Avatar for freefolder 13. freefolder 1 pt. 8,338
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,124
  5. Avatar for Deleted group 15. Deleted group pts. 8,118
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,769
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 7,665
  8. Avatar for BOINC@Poland 18. BOINC@Poland 1 pt. 6,737
  1. Avatar for snafur 151. snafur Lv 1 1 pt. 7,949
  2. Avatar for martinf 152. martinf Lv 1 1 pt. 7,947
  3. Avatar for NotJim99 153. NotJim99 Lv 1 1 pt. 7,946
  4. Avatar for nils2010 154. nils2010 Lv 1 1 pt. 7,929
  5. Avatar for Deleted player 155. Deleted player pts. 7,915
  6. Avatar for cgriebell 156. cgriebell Lv 1 1 pt. 7,911
  7. Avatar for Sydefecks 157. Sydefecks Lv 1 1 pt. 7,894
  8. Avatar for lightnir 158. lightnir Lv 1 1 pt. 7,894
  9. Avatar for pizpot 159. pizpot Lv 1 1 pt. 7,883
  10. Avatar for Neil_Young_dubstep_remix 160. Neil_Young_dubstep_remix Lv 1 1 pt. 7,882

Comments