Placeholder image of a protein
Icon representing a puzzle

1247: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 15, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for xkcd 11. xkcd 2 pts. 8,504
  2. Avatar for D001x Med Chem MOOC 12. D001x Med Chem MOOC 1 pt. 8,392
  3. Avatar for freefolder 13. freefolder 1 pt. 8,338
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,124
  5. Avatar for Deleted group 15. Deleted group pts. 8,118
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,769
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 7,665
  8. Avatar for BOINC@Poland 18. BOINC@Poland 1 pt. 6,737
  1. Avatar for Wang Lu 171. Wang Lu Lv 1 1 pt. 7,705
  2. Avatar for Feuervogel 172. Feuervogel Lv 1 1 pt. 7,698
  3. Avatar for yosi0 173. yosi0 Lv 1 1 pt. 7,690
  4. Avatar for Cerzax 174. Cerzax Lv 1 1 pt. 7,690
  5. Avatar for gillg02 175. gillg02 Lv 1 1 pt. 7,683
  6. Avatar for Anamfija 176. Anamfija Lv 1 1 pt. 7,683
  7. Avatar for EcolimRNA 177. EcolimRNA Lv 1 1 pt. 7,674
  8. Avatar for Altercomp 178. Altercomp Lv 1 1 pt. 7,672
  9. Avatar for fuzzykitty3 179. fuzzykitty3 Lv 1 1 pt. 7,670
  10. Avatar for HMK 180. HMK Lv 1 1 pt. 7,665

Comments