Placeholder image of a protein
Icon representing a puzzle

1247: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 15, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for xkcd 11. xkcd 2 pts. 8,504
  2. Avatar for D001x Med Chem MOOC 12. D001x Med Chem MOOC 1 pt. 8,392
  3. Avatar for freefolder 13. freefolder 1 pt. 8,338
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,124
  5. Avatar for Deleted group 15. Deleted group pts. 8,118
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,769
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 7,665
  8. Avatar for BOINC@Poland 18. BOINC@Poland 1 pt. 6,737
  1. Avatar for 100Gamers 191. 100Gamers Lv 1 1 pt. 6,949
  2. Avatar for brocl 192. brocl Lv 1 1 pt. 6,777
  3. Avatar for mpowroznik 193. mpowroznik Lv 1 1 pt. 6,737
  4. Avatar for Deleted player 194. Deleted player 1 pt. 6,703
  5. Avatar for Chouquet 195. Chouquet Lv 1 1 pt. 6,693
  6. Avatar for cieplysdz 196. cieplysdz Lv 1 1 pt. 6,662
  7. Avatar for GoodGuyGreg 197. GoodGuyGreg Lv 1 1 pt. 5,959
  8. Avatar for Andrew1620 198. Andrew1620 Lv 1 1 pt. 4,232
  9. Avatar for justjustin 199. justjustin Lv 1 1 pt. 0
  10. Avatar for Ellis Shih 200. Ellis Shih Lv 1 1 pt. 0

Comments