Placeholder image of a protein
Icon representing a puzzle

1247: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 15, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for xkcd 11. xkcd 2 pts. 8,504
  2. Avatar for D001x Med Chem MOOC 12. D001x Med Chem MOOC 1 pt. 8,392
  3. Avatar for freefolder 13. freefolder 1 pt. 8,338
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,124
  5. Avatar for Deleted group 15. Deleted group pts. 8,118
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,769
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 7,665
  8. Avatar for BOINC@Poland 18. BOINC@Poland 1 pt. 6,737
  1. Avatar for pauldunn 21. pauldunn Lv 1 60 pts. 9,698
  2. Avatar for Deleted player 22. Deleted player 58 pts. 9,697
  3. Avatar for crpainter 23. crpainter Lv 1 57 pts. 9,683
  4. Avatar for reefyrob 24. reefyrob Lv 1 55 pts. 9,675
  5. Avatar for Idiotboy 25. Idiotboy Lv 1 53 pts. 9,654
  6. Avatar for KarenCH 26. KarenCH Lv 1 52 pts. 9,652
  7. Avatar for Scopper 27. Scopper Lv 1 51 pts. 9,647
  8. Avatar for dembones 28. dembones Lv 1 49 pts. 9,642
  9. Avatar for nicobul 29. nicobul Lv 1 48 pts. 9,640
  10. Avatar for g_b 30. g_b Lv 1 46 pts. 9,638

Comments