Placeholder image of a protein
Icon representing a puzzle

1247: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 15, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for xkcd 11. xkcd 2 pts. 8,504
  2. Avatar for D001x Med Chem MOOC 12. D001x Med Chem MOOC 1 pt. 8,392
  3. Avatar for freefolder 13. freefolder 1 pt. 8,338
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,124
  5. Avatar for Deleted group 15. Deleted group pts. 8,118
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,769
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 7,665
  8. Avatar for BOINC@Poland 18. BOINC@Poland 1 pt. 6,737
  1. Avatar for Bletchley Park 31. Bletchley Park Lv 1 45 pts. 9,633
  2. Avatar for fiendish_ghoul 32. fiendish_ghoul Lv 1 44 pts. 9,627
  3. Avatar for Norrjane 33. Norrjane Lv 1 43 pts. 9,625
  4. Avatar for Anfinsen_slept_here 34. Anfinsen_slept_here Lv 1 41 pts. 9,614
  5. Avatar for toshiue 35. toshiue Lv 1 40 pts. 9,613
  6. Avatar for Satina 36. Satina Lv 1 39 pts. 9,612
  7. Avatar for tokens 37. tokens Lv 1 38 pts. 9,612
  8. Avatar for jobo0502 38. jobo0502 Lv 1 37 pts. 9,611
  9. Avatar for Fetztastic 39. Fetztastic Lv 1 36 pts. 9,610
  10. Avatar for Mike Lewis 40. Mike Lewis Lv 1 35 pts. 9,596

Comments