Placeholder image of a protein
Icon representing a puzzle

1247: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 15, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for xkcd 11. xkcd 2 pts. 8,504
  2. Avatar for D001x Med Chem MOOC 12. D001x Med Chem MOOC 1 pt. 8,392
  3. Avatar for freefolder 13. freefolder 1 pt. 8,338
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,124
  5. Avatar for Deleted group 15. Deleted group pts. 8,118
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,769
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 7,665
  8. Avatar for BOINC@Poland 18. BOINC@Poland 1 pt. 6,737
  1. Avatar for egran48 41. egran48 Lv 1 33 pts. 9,585
  2. Avatar for jermainiac 42. jermainiac Lv 1 32 pts. 9,584
  3. Avatar for Crossed Sticks 43. Crossed Sticks Lv 1 31 pts. 9,571
  4. Avatar for hansvandenhof 44. hansvandenhof Lv 1 31 pts. 9,562
  5. Avatar for hpaege 45. hpaege Lv 1 30 pts. 9,549
  6. Avatar for grogar7 46. grogar7 Lv 1 29 pts. 9,541
  7. Avatar for Glen B 47. Glen B Lv 1 28 pts. 9,540
  8. Avatar for isaksson 48. isaksson Lv 1 27 pts. 9,540
  9. Avatar for mimi 49. mimi Lv 1 26 pts. 9,540
  10. Avatar for cbwest 50. cbwest Lv 1 25 pts. 9,498

Comments