Placeholder image of a protein
Icon representing a puzzle

1247: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 15, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for xkcd 11. xkcd 2 pts. 8,504
  2. Avatar for D001x Med Chem MOOC 12. D001x Med Chem MOOC 1 pt. 8,392
  3. Avatar for freefolder 13. freefolder 1 pt. 8,338
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,124
  5. Avatar for Deleted group 15. Deleted group pts. 8,118
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,769
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 7,665
  8. Avatar for BOINC@Poland 18. BOINC@Poland 1 pt. 6,737
  1. Avatar for joremen 51. joremen Lv 1 24 pts. 9,493
  2. Avatar for pvc78 52. pvc78 Lv 1 24 pts. 9,469
  3. Avatar for guineapig 53. guineapig Lv 1 23 pts. 9,451
  4. Avatar for drumpeter18yrs9yrs 54. drumpeter18yrs9yrs Lv 1 22 pts. 9,451
  5. Avatar for diamonddays 55. diamonddays Lv 1 21 pts. 9,445
  6. Avatar for weitzen 56. weitzen Lv 1 21 pts. 9,444
  7. Avatar for TomTaylor 57. TomTaylor Lv 1 20 pts. 9,430
  8. Avatar for NinjaGreg 58. NinjaGreg Lv 1 19 pts. 9,429
  9. Avatar for jamiexq 59. jamiexq Lv 1 19 pts. 9,419
  10. Avatar for altejoh 60. altejoh Lv 1 18 pts. 9,408

Comments