Placeholder image of a protein
Icon representing a puzzle

1247: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
June 15, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for Contenders 100 pts. 9,880
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 74 pts. 9,847
  3. Avatar for Go Science 3. Go Science 54 pts. 9,837
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 9,819
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 9,818
  6. Avatar for Beta Folders 6. Beta Folders 18 pts. 9,817
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 12 pts. 9,805
  8. Avatar for Deleted group 8. Deleted group pts. 9,451
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 9,344
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,268

  1. Avatar for Galaxie 11. Galaxie Lv 1 78 pts. 9,804
  2. Avatar for frood66 12. frood66 Lv 1 76 pts. 9,802
  3. Avatar for christioanchauvin 13. christioanchauvin Lv 1 74 pts. 9,799
  4. Avatar for Skippysk8s 14. Skippysk8s Lv 1 72 pts. 9,797
  5. Avatar for Deleted player 15. Deleted player pts. 9,774
  6. Avatar for dcrwheeler 16. dcrwheeler Lv 1 68 pts. 9,774
  7. Avatar for actiasluna 17. actiasluna Lv 1 67 pts. 9,745
  8. Avatar for Bruno Kestemont 18. Bruno Kestemont Lv 1 65 pts. 9,738
  9. Avatar for ZeroLeak7 19. ZeroLeak7 Lv 1 63 pts. 9,709
  10. Avatar for Blipperman 20. Blipperman Lv 1 61 pts. 9,709

Comments