Placeholder image of a protein
Icon representing a puzzle

1247: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
June 15, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for Contenders 100 pts. 9,880
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 74 pts. 9,847
  3. Avatar for Go Science 3. Go Science 54 pts. 9,837
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 9,819
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 9,818
  6. Avatar for Beta Folders 6. Beta Folders 18 pts. 9,817
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 12 pts. 9,805
  8. Avatar for Deleted group 8. Deleted group pts. 9,451
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 9,344
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,268

  1. Avatar for egran48 41. egran48 Lv 1 33 pts. 9,585
  2. Avatar for jermainiac 42. jermainiac Lv 1 32 pts. 9,584
  3. Avatar for Crossed Sticks 43. Crossed Sticks Lv 1 31 pts. 9,571
  4. Avatar for hansvandenhof 44. hansvandenhof Lv 1 31 pts. 9,562
  5. Avatar for hpaege 45. hpaege Lv 1 30 pts. 9,549
  6. Avatar for grogar7 46. grogar7 Lv 1 29 pts. 9,541
  7. Avatar for Glen B 47. Glen B Lv 1 28 pts. 9,540
  8. Avatar for isaksson 48. isaksson Lv 1 27 pts. 9,540
  9. Avatar for mimi 49. mimi Lv 1 26 pts. 9,540
  10. Avatar for cbwest 50. cbwest Lv 1 25 pts. 9,498

Comments